PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010904650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 309aa    MW: 34505.5 Da    PI: 7.4316
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010904650.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1691.5e-52111401128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkk...leleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     lppGfrFhP+d+el+++yL+ kv+g++   +  + +i +vd++k+ePwdLp+++  + kewyfFs rd+kyatg+r+nrat +gyWkatgkd+++
  XP_010904650.1  11 LPPGFRFHPRDDELICDYLATKVAGDRsgsFWGSPMIVDVDLNKCEPWDLPEMACVGGKEWYFFSLRDRKYATGQRANRATLTGYWKATGKDRPI 105
                     79***********************99655333457***************7667799************************************* PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +g lvg++ktLvfy+grapkg+ktdWvmhe+r+
  XP_010904650.1 106 AR-RGVLVGMRKTLVFYQGRAPKGKKTDWVMHEFRM 140
                     *9.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-604162IPR003441NAC domain
PROSITE profilePS5100556.79411162IPR003441NAC domain
PfamPF023651.3E-2512140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MSCLSMVEAN LPPGFRFHPR DDELICDYLA TKVAGDRSGS FWGSPMIVDV DLNKCEPWDL  60
PEMACVGGKE WYFFSLRDRK YATGQRANRA TLTGYWKATG KDRPIARRGV LVGMRKTLVF  120
YQGRAPKGKK TDWVMHEFRM EGSSDLPKFF KEDWVLCRVF YKRMGISTKP SMETSYDDTG  180
SSSLPPLMDT YITLDQTPQN FEGFEQVPCF SSFPPSHTSQ HPNPLLAPHL HPVEISLPLT  240
KGLAQLGDLP DLGSCVNPLS TDRKVIKAVL NQLTKLEGNP KGEVPPTLAE GSLGGYFSET  300
GLPSAWNPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-5451639169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010904650.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE61e-103NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLM0TBT01e-156M0TBT0_MUSAM; Uncharacterized protein
TrEMBLM0U3M11e-156M0U3M1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P31350_0011e-156(Musa acuminata)
STRINGGSMUA_Achr9P26140_0011e-156(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101237138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-104NAC domain containing protein 1